PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0039s0181.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 95aa    MW: 10492.1 Da    PI: 10.5921
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0039s0181.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA48.51.2e-155385133
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33
                         C+ Cg t+Tp WRrgp+g+ tLCn CGl+y ++
  Kaladp0039s0181.1.p 53 CEFCGCTETPTWRRGPSGPNTLCNRCGLRYMRN 85
                         *****************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.5584782IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-114794IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-134988No hitNo description
Gene3DG3DSA:3.30.50.106.8E-145088IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.60E-125282No hitNo description
PfamPF003207.3E-135385IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MEQGSNSSQN KQKIDTTLKL GLPQFHREHS SPELIPKPKP KSKGPKVVPG RVCEFCGCTE  60
TPTWRRGPSG PNTLCNRCGL RYMRNQKKAK NAEA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013893355.12e-13hypothetical protein MNEG_13626
TrEMBLA0A0D2MH062e-13A0A0D2MH06_9CHLO; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-10GATA transcription factor 1